Wcześniejsze:    Most Roman Ingarden Jan Woleński Żory, Biblioteka Tomasz Jastrun Capella Cracoviensis Kule Krk800mm Hala Gliwice Port Staw Makoszowy Pogrzeb Józefy Hennelowej Pogrzeb Zofii Skwarnickiej Balon Bunkier Capella Cracoviensis Nikiszowiec Krakowska Brzeg Mosty Wrocław

      MaPaK AGH Edukacja Różne Rodzina Kontakt Linki ENG

Cytaty   ostatni miesiąc   wszystkie   all quatations, since 2014 Thx to: 3 Quarks Daily

Proteins CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC these forty letters are a set of instructions for building a sophisticated medical device .. smaller than the virus on which it operates
 …  Proteins .. do most of the work of life. Antibodies .. are proteins. So are hormones .. enzymes
 …  A protein is a large molecule built from smaller molecules called amino acids. Our bodies use twenty amino acids to create proteins; our cells chain them together, following instructions in our DNA.
 …  CI.. cysteine and isoleucine
 …  Designer proteins .. cure diseases .. new kinds of materials and electronics .. create and transform life itself
 …  Protein design is hard for lots of reasons. Evolution has had billions of years to explore, by trial and error
 …  Nature .. using the ultimate parallel-processing computer: the universe.
 …  RosettaCommons .. “sampling method” and an “energy function”
 …  a system of directed evolution
 …  developing A.I. to do the selecting
 …  trying to change the way that technology and engineering on the molecular scale are done in biology /20-09-25

/20-09-25

Noam Chomsky
 …  concern for the COVID-19 crisis is virtually all-consuming. That’s understandable. It is severe and is severely disrupting lives. But it will pass, though at horrendous cost, and there will be recovery. There will not be recovery from the melting of the arctic ice sheets and the other consequences of global warming.
 …  Trump and his courtiers take pride in leading the race to destruction
 …  people who breathed dirtier air were about twice as likely to die from the infection
 …  Dismantling capitalism is impossible in the time frame that we have for taking urgent action
 …  The Green New Deal is the only approach to climate stabilization also capable of reversing rising inequality and defeating global neoliberalism and ascendant neofascism
 …  the old is dying and the new cannot be born; in this interregnum, a great variety of morbid symptoms appear /20-09-20

Popularyzacja nauki PAUza Akademicka nr. 523
 …  większość publicystów .. ma nikłe pojęcie o tym, co to jest metoda naukowa badania rzeczywistości
 …  Scientia PAUperum
 …  jakie są tutaj dopuszczalne granice uproszczeń .. w którym momencie stają się szkodliwe
 …  1933, Stanisław Loria, fizyk .. Bardzo szkodliwe jest mniemanie, że do napisania artykułu lub książki popularnonaukowej niepotrzebna jest gruntowna wiedza fachowa, lecz wystarczy dość powierzchowna znajomość przedmiotu .. O wiele łatwiej jest napisać dobry referat naukowy, przeznaczony dla uczonych, aniżeli dobry artykuł lub wykład popularny dla laików. .. Krzykliwe tytuły, jaskrawe przeciwstawienia, reklamiarska przesada, facecje i kpiarstwo .. do uśpienia czujności lękliwego czytelnika, który by w panicznym strachu uciekł przed nudą wykładu .. Nie wierzę jednak w skuteczność i celowość takiej „popularyzacji” /20-09-18

capitalism isn't working. Here's an alternative
 …  future transformed by Covid-19
 …  democratic socialism
 …  Margaret Thatcher .. There is no alternative
 …  when the Soviet Union collapsed in 1991 .. social democrats, Keynesians and Marxists alike .. in 2008, with Lehman’s collapse
 …  how democratic socialism could work today, with our current technologies and despite our human failings
 …  precisely how would things – like money, companies and housing – work?
 …  Another Now .. a Marxist-feminist, a libertarian ex-banker and a maverick technologist
 …  central banks provide every adult with a free bank account into which a fixed stipend (called universal basic dividend) is credited monthly
 …  People receive two types of income: the dividends credited into their central bank account and earnings from working in a corpo-syndicalist company. Neither are taxed
 …  All trade and all money movements between different monetary jurisdictions (eg the UK and the eurozone or the US) are denominated in a new digital accounting unit, called the Kosmos. /20-09-17

brains have evolved to the point where we can build artificial brains that might help us understand our brains
 …  novel insights and deep analyses enabled by smart instruments and machine learning
 …  revolutionized workflows
 …  DNA .. researchers have not yet succeeded in demonstrating a route from raw chemical materials to those crucial macromolecules
 …  a sort of self-motivation to replicate .. the dawn of intelligence
 …  self-driving microscopes
 …  can conceive of, build, and manipulate models of itself
 …  The master is becoming the student. /20-09-17

AI tools are shaping next-generation theorem provers, and with them the relationship between math and machine.
 …  Cohen .. all of mathematics could be automated
 …  crazy contact between an imaginary, nonphysical world and biologically evolved creatures .. We did not evolve to do this
 …  proofs generally follow deductive, step-by-step logic. They often require complicated creative thinking
 …  the possibility of automating reason itself
 …  2016 .. a computer program to prove .. the Boolean Pythagorean triples problem .. 200 terabytes
 …  Computers have done amazing calculations for us, but they have never solved a hard problem on their own
 …  computer proofs may not be as alien as we think
 …  teaching tools .. It forces you to be very organized and think clearly
 …  By the time I’ve reframed my question into a form that could fit into this technology, I would have solved the problem myself.
 …  theorem provers replace human referees at major journals
 …  the communication barrier between the language of humans and the language of computers
 …  What an ATP doesn’t do is explain its work .. it’s impossible to scan the proof and follow the reasoning, because it looks like a pile of random data.
 …  new conjectures generated by a neural network trained on theorem-proving data
 …  Neural networks are able to develop an artificial style of intuition
 …  computers will be able to out-reason mathematicians by 2099
 …  Even if computers understand, they don’t understand in a human way /20-09-11

Naiwność jako jakość estetycznie doniosła Roman Ingarden /20-09-02

Probability The New Yorker
 …  In a group of just twenty-three people, there’s a fifty per cent chance that two of them share a birthday
 …  one of three doors to win a prize. The Monty Hall problem
 …  It should be a fifty-fifty shot, but it always takes me at least six tries to insert a USB dongle into my mouth.
 …  There are 8.06e + 67 different ways to shuffle a deck of cards. Most people can’t wrap their head around the magnitude of this number. It helps if you think of something pretty big, like a horse, or one of those larger-sized microwaves. /20-09-02

... ... ... 2014